PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00014716-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 530aa    MW: 59503.8 Da    PI: 7.7824
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00014716-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.7e-1671113145
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       +g+W++eEd +l +a+k++G++ W+ Ia+ ++ gRt++ +k+r++
  PSME_00014716-RA  71 KGSWSQEEDIILFEAHKKFGNR-WTEIAKVVQ-GRTDNAVKNRFN 113
                       799*******************.*********.**********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.59E-2058128IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.4E-2161119IPR009057Homeodomain-like
PROSITE profilePS5129421.54866120IPR017930Myb domain
SMARTSM007174.4E-1770118IPR001005SANT/Myb domain
PfamPF002493.6E-1571113IPR001005SANT/Myb domain
CDDcd001671.33E-1273115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009553Biological Processembryo sac development
GO:0010052Biological Processguard cell differentiation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 530 aa     Download sequence    Send to blast
MDPPGHFQFQ ANNTNSNNNP DKSRGDRHFV TWSEQVLGSW MIGQEDNILR EQVRIHGIER  60
WNTYLSTAYK KGSWSQEEDI ILFEAHKKFG NRWTEIAKVV QGRTDNAVKN RFNALCKKQA  120
KREALSKEND EQIHVNDNNK RDLVENKSIL KTLDPAVCSK KMRTSNISGV FPGDGAIQLM  180
TQDRGSESMS HLRTALTVLP HDRLTNKGFL VSLGHSSPRD PFAAIKSPVN QGSKLQNAFL  240
SKDNPKLSAL NQQAELLSTL VQRRKVETSN QKLENSSKVA DRMLIQGKES HLRNEDEMKE  300
SSPCLDLRTN ASTPLLTDKE KGPKATCLPS KRLHMPSLPK LCEPCEKTSQ ESSEFSLGSN  360
YRMNFFDMPK DNPLQIGMSA FICKNKSFQT CSTNTEEKEQ VQDGYSCSTA SKHVISSKQT  420
EQEDERLVPI SSFAECCSPI HVTPCFRSFV DGIPSPQFSD SERQFLLSML DPDSEISSPD  480
CQILSRRGSP SCRTSLSNRL GKKNETEVEE GNRGGDDQLI YISLCVSSIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-185911947107B-MYB
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1174640.0BT117464.1 Picea glauca clone GQ03901_A18 mRNA sequence.
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14350.22e-62MYB family protein